PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10021411m
Common NameCARUB_v10021411mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 292aa    MW: 33916.8 Da    PI: 6.5096
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10021411mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.62.4e-172471148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll ++v   G g+W+ +a++ g++Rt+k+c++rw++yl
  Carubv10021411m 24 RGPWTLEEDTLLTNYVLHNGEGRWNHVAKCAGLKRTGKSCRLRWLNYL 71
                     89********************************************97 PP

2Myb_DNA-binding51.91.8e-1677120146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T++E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Carubv10021411m  77 RGNLTPQEQLLILELHSKWGNR-WSKIAQYLP-GRTDNEIKNYWRT 120
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.2041971IPR017930Myb domain
SuperFamilySSF466891.16E-3021118IPR009057Homeodomain-like
SMARTSM007173.5E-142373IPR001005SANT/Myb domain
PfamPF002497.5E-162471IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-222578IPR009057Homeodomain-like
CDDcd001671.06E-92671No hitNo description
PROSITE profilePS5129425.26472126IPR017930Myb domain
SMARTSM007171.4E-1476124IPR001005SANT/Myb domain
PfamPF002491.5E-1577120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.0E-2379125IPR009057Homeodomain-like
CDDcd001679.13E-1181120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009686Biological Processgibberellin biosynthetic process
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MENSMKKKKS FIKESDHQDV ELRRGPWTLE EDTLLTNYVL HNGEGRWNHV AKCAGLKRTG  60
KSCRLRWLNY LKPDIRRGNL TPQEQLLILE LHSKWGNRWS KIAQYLPGRT DNEIKNYWRT  120
RVQKQARQLN IESNSDKFFD AVRSFWVPRL MEKMEQNSST TTYCCPQSNN NNNSLLLPSQ  180
SQDSMMSSTI QKDKDFSSQN LSLSNMDSSS TSTWAVPHFM DHNNTNIIDS SMCFHQGNDQ  240
ELGGYVPIGM ENYLGNSDIS MECHVADGYS TYEDVTQDPM WNMDDIWQFR E*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-242112624128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00216DAPTransfer from AT1G68320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195680.0AY519568.1 Arabidopsis thaliana MYB transcription factor (At1g68320) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006301020.10.0hypothetical protein CARUB_v10021411mg
SwissprotQ9LDE11e-64MY108_ARATH; Transcription factor MYB108
TrEMBLR0IBB90.0R0IBB9_9BRAS; Uncharacterized protein
STRINGAT1G68320.11e-166(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26322571
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.11e-154myb domain protein 62